DPCstruct | MC29114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21203 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564Y0H4 | 13-103 | LFFSVFAEDDFSSLNVIIEHSFDEGKTFKPKATISSWTNGGITHLVKEPALTNEEQLLLAKLSLTDSMYVIRAYTKPNSFVLMSSCQ… |
| A0A151IGU9 | 137-220 | YDGWLQLRLWHAFNDDPVPVFTERGNVTVSSVRSGASVVGQNGLLPAQINALKNLAEHDGKYRLKALARISSGSEIVFLTSVPA |
| A9VA42 | 152-257 | None |
| A0A1D6PS63 | 67-162 | None |
| A0A6J0J7X1 | 37-132 | None |
| A0A7R9KI30 | 252-339 | None |
| A0A1Y3BKW3 | 1-97 | None |
| A0A2T7PIJ3 | 10-116 | None |
| A0A843WCA4 | 48-154 | None |
| A0A5J9URY9 | 65-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.