DPCstruct | MC29111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 232 ± 47 aa |
| Standard deviation of domain lengths | 46.78 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 81.09 |
| Assigned Pfam label(s) | PF19438- CL0235- PF06584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7I9G5 | 2-184 | LVILVKVAKLLDIKKKLIKTLTELNNEAERESILTDKYTPIFQERYARTVVDLETVNRQVNIYLNGIQEYNSQLLPQLSEVSISARP… |
| A0A0X3PSL8 | 2-232 | PTACRLATHESSLSPTFQPMDEFAGEVDMSNFIISLAKSYRILYQKEKAVAILKEMNDKVESSKSEDDSLITADFQHEYATLVLHLD… |
| B4I9L3 | 164-445 | None |
| A0A6A5DFA4 | 519-718 | None |
| A0A2A2KNI0 | 353-581 | None |
| A0A5K3ELA8 | 243-428 | None |
| A0A7J7J9H7 | 84-293 | None |
| A0A1I8HMW5 | 151-458 | None |
| A0A6F9DJX0 | 276-538 | None |
| A0A5K3EYV2 | 280-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.