DPCstruct | MC29110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 325 ± 66 aa |
| Standard deviation of domain lengths | 66.43 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.49 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | PF09815- CL0056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X3PQV4 | 16-325 | YLLDKRASVDPPRSTKAWIIRLVLHALQLAPIVRLTDAVLYGIASRRPGISLTQAVHLTRMMLYEDADSCMLRLIECFMESAPQLLL… |
| A0A7S2FFX8 | 129-460 | HFLWAAALFCGYADLITTVLVAFAYLRMGTEGRIAAYLIFGVLAAHLLTEAIISLGTGQGSLAALVSLGGGKLLWSTWHVVENRPIG… |
| A0A2B4SA35 | 255-600 | None |
| A0A7R9A529 | 261-539 | None |
| A0A4W6ECQ4 | 14-279 | None |
| A0A7R9A094 | 18-316 | None |
| A0A6P4EAN8 | 6-218 | None |
| C3ZQ25 | 24-356 | None |
| A0A672UNH8 | 44-407 | None |
| E9FYJ4 | 19-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.