DPCstruct | MC29107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 20 aa |
| Standard deviation of domain lengths | 19.75 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4ICF6 | 62-186 | AREMGRRVFEWDQVKALMACRLVALDKCPGVRPVGIGEAIRRLLGKAVMKETREELQEACGADQLCSGLMGGLEGGIHAVRELWETL… |
| A0A0G4FTD3 | 1-117 | MASRIANEDVPWEQLQALRACRLIGLDKQPGVRPIGIEEVLMRIMGKAMAKAVGVDAEIVCGADQLCAGLKGGVEGAIHAVSGPFDS… |
| A0A6H5GGZ8 | 1-70 | None |
| A0A6S7HGM6 | 128-204 | None |
| A0A0G4HB44 | 62-186 | None |
| A0A6S7GA38 | 116-228 | None |
| A0A1X7TFK6 | 122-233 | None |
| A0A1X7TVL9 | 1-108 | None |
| A0A0G4I6V3 | 275-397 | None |
| A0A7D9I357 | 444-523 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.