DPCstruct | MC29103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 236 ± 47 aa |
| Standard deviation of domain lengths | 47.01 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 66.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.43 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | PF12269- CL0229- PF02008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F5REE2 | 7-273 | ISHEEIVKQFSLPERQSKIDTLLKQDGQAYCLCRSSDSSRFMIACDACEEWYHGDCIAISEKEAKLIKQYVCIRCHEEDPTLITRWK… |
| A0A0K8SEV0 | 4-284 | REEIARQFQLPERKSKIATLLKQDGQVYCVCRSTDSSRFMIGCDLCEEWFHGDCIGISKKDAKNIKQYFCEKCQPDDPTLSIVFKSS… |
| B4ILQ4 | 8-330 | None |
| A0A1L8ELT5 | 202-374 | None |
| A0A5N5T027 | 1-225 | None |
| A0A3Q1EEK7 | 386-583 | None |
| B4IPY5 | 11-234 | None |
| A0A151I5A6 | 281-563 | None |
| A0A0P5RZ48 | 513-698 | None |
| H9J6C2 | 7-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.