DPCstruct | MC29101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 14.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5J9H0 | 23-147 | RIEITSIESPAFGGRQFGNVGAYEKLRGKAYGELNPLDPQNAKITDIQLAPRNKRGMVEYSTDFYILKPINLLRGNRKLFEEIPNRG… |
| A0A6G3Q5F5 | 7-136 | EPQESPVRLEIHSREPFADGHRFAGSGAYEVITATAHYSVDPDAPAHDSITDLALAPRDSTGRVRFSGDVEILRPVGGGRRRLFFDW… |
| A0A818SBA9 | 2-149 | None |
| A0A370I780 | 5-121 | None |
| A0A1E4P450 | 31-170 | None |
| A0A538B0F0 | 3-175 | None |
| A0A1H0WCI0 | 4-177 | None |
| A8TP13 | 1-145 | None |
| H6RR41 | 21-148 | None |
| A0A819QN25 | 165-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.