DPCstruct | MC29100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 53.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165JJP5 | 6-71 | CHPQACAIQDCLSKSNYNEDKCKRQIDALYECCNTFYQQHGDNASSVSCPKAGLLRLKMKQRGLEK |
| A0A212M8S2 | 5-71 | TPPCKPQACAIQNCLLSNDYNEGKCDHLVDDLYRCCQRFYQDTEGQERTPCCPQPDLLKLKMSQRRL |
| Q2HG94 | 2-59 | None |
| R9XKA2 | 47-112 | None |
| A0A2T5M228 | 1-51 | None |
| A0A0F2M6M1 | 126-190 | None |
| A0A074Y9I9 | 13-67 | None |
| Q755I8 | 24-94 | None |
| D4B310 | 107-164 | None |
| A0A545V2P7 | 62-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.