DPCstruct | MC2910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 151 ± 19 aa |
| Standard deviation of domain lengths | 18.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226D501 | 2-134 | WLKFFQDAQIPADFASKYALIFHENRMRTNMLLDISKECLKDMGIVAMGDIIAILKHAKQVHEQSKYNLYEDDTNQNRDTSSSPPVT… |
| A0A224YNR9 | 10-150 | SQWVQFFRAAGLPQDVSVQYAVVFGDNRIQWGMLMDLTKEYLFDMGIHTMGDVIAILKHAKYVHSKEAQEKLMRSTPSGAQMAVGIP… |
| A0A4U5LWT8 | 1-124 | None |
| A0A131YWE2 | 1-152 | None |
| V4A2Y0 | 10-180 | None |
| E4XVR0 | 4-159 | None |
| A0A164XDN6 | 1-181 | None |
| A0A7M5U846 | 6-172 | None |
| A0A3P7C474 | 2-111 | None |
| A0A4W3HU96 | 35-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.