DPCstruct | MC291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 17.36 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.01 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0125- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7AMS5 | 169-252 | RYLLYDVNPPEGFNLRRDVYIRVASLLKTLLKTEEWVLVLPPWGRLYHWQSPDILQVRIPWSDFFDLPSLNRNIPVIEYEQFIA |
| A0A6J3A411 | 43-135 | VNLRNKTQGYLLCDFNPPEGFSLRRNVCIHIALLLKTLLEMEEPVLVLSPWGHLYHWQNPNINQVWIPWSDSFDLPSLNRNNPDIEY… |
| A0A6J1XXM0 | 65-167 | None |
| A0A182S6Q9 | 57-147 | None |
| A0A4X2MCV3 | 5-105 | None |
| E2A6V7 | 1-96 | None |
| A0A1G4GV04 | 24-161 | None |
| A0A7R8W071 | 1-179 | None |
| A0A813FZH1 | 149-244 | None |
| A0A1B1DXW6 | 171-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.