DPCstruct | MC29097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 458 ± 53 aa |
| Standard deviation of domain lengths | 52.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1ECR8 | 150-636 | YDSYLKPLVEQPGSTYKLYRDDPTRFETYATLVEGGVFPHQKRVNAGDADAAKLNTSLLVIGSLMWDPMLPGFGFSSMARQMITKFV… |
| A0A165IBR2 | 83-587 | LEPDEKLYLPFLKPLLEKRNSTYKLAPWSGVEWSSYMRIAEEGFLPHQKLLPSGHEALNKPSDTLLFVANLGHYPPKKRGSFNSIAA… |
| A0A545VT02 | 475-926 | None |
| A0A4U0VN65 | 2-465 | None |
| G2XPF7 | 2-365 | None |
| A0A175VSM1 | 1102-1565 | None |
| A0A166MNP5 | 354-818 | None |
| H0EPE6 | 3-333 | None |
| A0A420HR11 | 694-1222 | None |
| A0A367LDZ0 | 178-679 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.