DPCstruct | MC29096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 21.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9XQM9 | 15-203 | YVRIRVLLYGSSKDDPVSDDRFGDRQRRVEIIFSLKLPRANMPPNDILQYATDFINLYYPCLKHTQKWHCEFCDLPARMSQQDVSSW… |
| A0A165HVW7 | 6-166 | ATVPVRFEFYILRSNTKLEFVHQFPKHFVGVGDPYGQSTDLYGQTSTTNNTTYVQEFQKAAYAILREHKDELPPTSDPACEFCGGPT… |
| S7PVH4 | 705-821 | None |
| S7PT78 | 5-149 | None |
| A0A2U3DQU7 | 2-122 | None |
| A0A3N4I456 | 103-245 | None |
| A0A370TCD2 | 54-213 | None |
| A0A5C3LJU6 | 81-197 | None |
| A0A2G8RNJ4 | 38-198 | None |
| S7RDT6 | 17-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.