DPCstruct | MC29095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 187 ± 48 aa |
| Standard deviation of domain lengths | 47.55 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165H7L3 | 7-196 | RVISEGNLRLLAEAGQVSETNQPGCRRVSTQYISPFASRDTLDIPDFFNSAAALVFCGMQPAVAENLFDEWQNLPEEHFAYGHDIDR… |
| A0A136IX34 | 15-139 | AVPSVLISHDTLLYLGLSERRAQSLWEEWTSWPSLGPWREVDADDGNLRVYFIDFVLGHFNNIPSTHGEDDASWRLCLALSGISWTL… |
| A0A0S7DZQ5 | 13-165 | None |
| A0A423WSD3 | 228-394 | None |
| A0A101MIY3 | 40-157 | None |
| A0A4Z1HB57 | 4-193 | None |
| A0A6A5UXU0 | 21-121 | None |
| A0A5N6JTT4 | 112-233 | None |
| A0A4Z0YCB5 | 41-185 | None |
| A0A4S2MQZ6 | 54-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.