DPCstruct | MC29089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 50 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 61.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q2V2P0 | 28-73 | MADPRQNLFTARLRAEDNCYWYAHSNPLETTLLPLRTTDGRPICAG |
| A0A1M5FFK9 | 1-55 | MAAPYQNLQLVRLKPEDGCYWYQHAGPVETTLLPLRTPEGRPICLQREGTPQMAG |
| A0A1H3MYH6 | 39-82 | None |
| A0A1M4ZSR1 | 103-148 | None |
| A0A1N7K3T0 | 65-110 | None |
| A0A1H9GUB1 | 1-49 | None |
| A0A0P7XFD9 | 42-96 | None |
| A0A1I3PBP8 | 76-130 | None |
| A0A2S5JHE2 | 54-100 | None |
| A0A2R8BQQ5 | 56-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.