DPCstruct | MC29087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 121 ± 20 aa |
| Standard deviation of domain lengths | 19.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.91 |
| Pfam Score | 74.51 |
| Assigned Pfam label(s) | CL0167- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9ERP4 | 22-162 | LEYFKHCAAHDFHLQRCDSCGLLRYPPTTACPWCASPKSTWTRVEGKGAVHSYSEVHHAIQPAFKAHTPYLILLVDLDAQKGKPTAD… |
| A0A1M5A8B8 | 6-118 | HFREGLAAGEIRLQRCATCGTHIFFPRVLCPACHGTDLHWIAASGAGEVYTFTTVRNRPEKGGDYNVAMVELAEGVRMMTRVDGDPH… |
| A0A6C0TX95 | 33-148 | None |
| A0A1F7T2A1 | 19-140 | None |
| A0A1P8RF35 | 2-120 | None |
| A0A7X4BXF4 | 106-239 | None |
| A0A523RGN1 | 1-114 | None |
| A0A7W0PHR5 | 1-83 | None |
| A0A2N2KIH6 | 352-481 | None |
| A0A7V8ZLM3 | 7-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.