DPCstruct | MC29085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 63.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821ZFD9 | 141-209 | DTEQERMIDRIKCIAFRAARDAGATFINRQWIADKIHRTTRFVTAWWEKSYDRCFTDYSNAGCKLKLSQ |
| A0A816B753 | 1-67 | MAGTYDTEGQRIVDINISIALCEAQDAGATFINRDWIAEKSHRSVRFITNRWQKPYGQCFADYSNTN |
| A0A815YIG5 | 1-68 | None |
| A0A816BTF5 | 5-69 | None |
| A0A817QSC0 | 69-141 | None |
| A0A819ZPB2 | 5-65 | None |
| A0A815JJK6 | 79-150 | None |
| A0A816RDY1 | 50-113 | None |
| A0A815U9S0 | 1-69 | None |
| A0A819LR64 | 2-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.