DPCstruct | MC29083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1056 |
|---|---|
| Mean domain length (aa) | 384 ± 86 aa |
| Standard deviation of domain lengths | 86.46 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.77 |
| Pfam Score | 80.84 |
| Assigned Pfam label(s) | CL0023- CL0489- CL0020- CL0512- PF12017 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8YCQ6 | 317-793 | HHFEWQPPLKNVSSSTDVGIIDGLSGLASSVDDYPVDTIAKRFRYDCALVSALMDMEEAILEGLRALGLADYLGGPFTVVVKESCDG… |
| A0A815Z2U6 | 107-533 | PPVYFFTFDLASQLQQILDCSTDLCLVNHAKNRPTTLQDIVDGEFYQRLLIAERGNNFLTLTMNVDGVSPNRSSSLSIWPVFLVINE… |
| A0A2H3BVA7 | 217-631 | None |
| G0P3U4 | 103-660 | None |
| A0A4S8MHQ7 | 346-838 | None |
| A0A4S8MBS1 | 44-424 | None |
| A0A818YWA1 | 560-1079 | None |
| A0A5N6Q144 | 448-748 | None |
| A0A2N9HZR0 | 121-489 | None |
| A0A3N4JB11 | 2-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.