DPCstruct | MC29079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 11.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819BY92 | 80-180 | MWAGRNRRELVNELCEIIQSVHPTIEPREEDGVIYFDRVTLCMMVNSETYIDEEFDLTKSPSGINELIFGIAKSLGREKMFQWFRTV… |
| A0A815WYA1 | 5-111 | RNRQTVLNEFKNILQKVHPDIQPFEEKKIIYFGQFGLCTMVNSVTYVDDDIGIRKDPSGVDELILGIAKSLDQQNRCTWLQAMNRDD… |
| A0A821JUU1 | 3-87 | None |
| A0A813PY92 | 45-147 | None |
| A0A821S207 | 1-109 | None |
| A0A819FYF8 | 4-106 | None |
| A0A815M636 | 358-473 | None |
| A0A819U0J4 | 53-147 | None |
| A0A815S469 | 1-90 | None |
| A0A817NI61 | 54-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.