DPCstruct | MC29078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 143 ± 31 aa |
| Standard deviation of domain lengths | 30.90 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816GDG6 | 4-102 | TLPVNVFKLRGEEFFQLVQEQCGATMVEILRYLEVMSADCLLHIEDLFAFFHYDSPDLLPIKKKVGITLNDGSFKVKVGLSIQANNF… |
| A0A815WQK7 | 87-213 | PSFVLPDNVLSLEGAEFFELVNRACGAAFKDLMKLLSINSVYKLLTAENDILLVFQKKYRELETIYEGACLHLEDGTMMLKPGLRLD… |
| A0A819WSS1 | 6-165 | None |
| A0A817RBK1 | 1-160 | None |
| A0A817QU16 | 6-133 | None |
| A0A816X5E3 | 3-164 | None |
| A0A816WEL6 | 81-245 | None |
| A0A815YG04 | 12-133 | None |
| A0A820QLX6 | 7-127 | None |
| A0A820QQE8 | 14-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.