DPCstruct | MC29074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 162 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7F7D9 | 87-260 | LTDEELEHRELLRRSDRAKMERMRHASADPKKLWTDYTVTNRESGKSYRVALRGWERGESYCTCPDFRKNTLGTCKHIMFVSGKMKA… |
| A0A3N5H417 | 2-158 | TTDIQEQIERRRERAREEILKIANKGSHPVFSQFEVKSVSGRAYRVEIRSLDEMQNSCTCPDYKTNLIGTCKHIEGVLIHLREEYGK… |
| A0A661YVX7 | 113-268 | None |
| D6SRL2 | 112-273 | None |
| A0A6L4ZAB5 | 22-196 | None |
| A0A3D6C7Q5 | 114-284 | None |
| A0A7X8XEZ1 | 1-159 | None |
| A0A7V7KBX9 | 7-141 | None |
| A0A0C9PD27 | 12-188 | None |
| A0A256WDB8 | 102-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.