DPCstruct | MC29073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 268 ± 48 aa |
| Standard deviation of domain lengths | 48.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5GY83 | 8-247 | IFAVQEELKNRGITLLIVIVPNKSTIYPDYMPAEIPVIGERSRLDQLSSYLRRGDKKIRVLDLRPALREARKEHQIYYSTDTHWNDY… |
| R6R0L6 | 64-360 | KEKAEGEITDDGLLIVKQDDHWRAMEQFGGGSGDSYVESLNNLRDKLDSSVKIYSMPAPLACEFYTPSNLSDNYVSQADCFSSIAKR… |
| A0A5C8CUE6 | 223-382 | None |
| A0A847CH17 | 2-216 | None |
| A0A2E4XMR0 | 142-415 | None |
| A0A5C8FBL2 | 3-243 | None |
| A0A244C4I9 | 3-187 | None |
| A0A259LXQ3 | 217-492 | None |
| A0A179S2B1 | 111-362 | None |
| A0A1V2M5U7 | 4-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.