DPCstruct | MC29071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 99 ± 13 aa |
| Standard deviation of domain lengths | 13.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T2V9Z9 | 4-106 | EPAKTEAYVVDVFGPVADPENDFADVYVRLEDGREYVATFLTPSYLRERMARHARTGEHGGGRYFWVEDMCIVASLDQQTVEMCVAD… |
| A0A7T9G4N5 | 16-115 | SIREIWLECEIWVNGWDTEDDNSDVIVTLEDGSRWLATFFTFSNIVSLRDEHALSGECLSGGYFWASDMILIDKLTRDRVEKVIKDQ… |
| A0A6G3ZRH2 | 3-99 | None |
| A0A2H0PB12 | 7-100 | None |
| A0A7W8QLV6 | 140-243 | None |
| A0A7H1APM4 | 135-252 | None |
| K4Z8A0 | 1-99 | None |
| A0A4Q7JEK5 | 1-89 | None |
| A0A841TQ37 | 4-107 | None |
| A0A7V1UMB7 | 48-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.