DPCstruct | MC29070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 262 ± 47 aa |
| Standard deviation of domain lengths | 46.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250XX90 | 25-263 | DIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLKKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHAL… |
| A0A7S1VAK5 | 32-243 | YQRREFVISRGLMDLKRLREREQAMYREDRELHLKLRPLMLVVSREDYEKFIDGLFAERSILLRIEQLQSWRSAGIRTLDEGEEYEL… |
| A0A0F7SIV5 | 472-696 | None |
| A0A4S9NRM0 | 191-476 | None |
| S0F2V5 | 237-557 | None |
| A0A7S2U9H2 | 318-670 | None |
| A0A0C9RTN0 | 65-331 | None |
| A0A438DQ37 | 2-171 | None |
| Q4N7P1 | 58-336 | None |
| A0A6P3ZG45 | 58-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.