DPCstruct | MC29067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Standard deviation of domain lengths | 3.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 64.59 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0431- CL0330 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4TJC8 | 1-58 | QETLLTVPRFCFPFSMDSLTVHQVGQNFTFVLTDIESKQRFGFCRLSSAAHTCYCFLR |
| A0A402EEB2 | 35-93 | DQETIQVLPKFCFPFDVERVKESPAVQHFTFGLTDLEGKQRFGFCRLAKGFRTCLCILR |
| A0A7F8RV15 | 43-100 | None |
| A0A0F8BUU0 | 1-70 | None |
| A0A7J8II06 | 43-100 | None |
| A0A6J1VNL7 | 18-75 | None |
| A0A673HML8 | 17-76 | None |
| Q8TEH3 | 43-100 | None |
| A0A6J0SLG7 | 40-98 | None |
| A0A667YMX9 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.