DPCstruct | MC29065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 153 ± 17 aa |
| Standard deviation of domain lengths | 16.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7L1U2 | 2-137 | DCYLTIIMPNPRLYVKDGRHQIEGFIVHKIPICSLHQTAMSEKHLIQREHLLYDSLSRAGMSNPHLECLRRERLLGMKGVIERYELC… |
| A0A4W6EWU1 | 143-277 | VFKNPICKVYRFQTMDSKWMLVREQMEECTLSFSIPKQLLSLYIQEDMSRVQDLRDLGELSPHWDNLRKEVMTRYGGIISSYQETLA… |
| A0A3L8RX65 | 988-1174 | None |
| A0A2A2KLV6 | 139-296 | None |
| A0A7I8VGD4 | 276-419 | None |
| E4Z6B4 | 15-149 | None |
| A0A6J2U2B0 | 6-173 | None |
| A0A4W3JVN5 | 88-229 | None |
| A0A0P7V9S9 | 2-133 | None |
| A0A817VKN0 | 57-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.