DPCstruct | MC29064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 75.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15243 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4YT68 | 1-109 | MSTPFPNLLPRVNDPLWFNLDKPCDDESELHHMEQAHKSWLESIAEKDNDIVPIGKTASETHDDDEDDNEGDDDDYEDSDDYDSVDD… |
| Q4T8Q8 | 1-122 | MSTLFPSLLPRITESLWFNLDRPCVDETELHQQEQQHQSWLQSIAEKDNNLIPIGKAIFEPGYEEEEEEDDEDEEDSEEDSEDEEDM… |
| A0A671RAW0 | 1-106 | None |
| A0A1A7YLM4 | 1-143 | None |
| A0A2K5DKW7 | 1-113 | None |
| A0A6P5CZ31 | 29-150 | None |
| A0A6P5IY68 | 48-169 | None |
| A0A2K5S7N6 | 10-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.