DPCstruct | MC29063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 127 ± 18 aa |
| Standard deviation of domain lengths | 18.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 44.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4T3I9 | 8-133 | IIGVTILSQLTNEINQADTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASGKNLNLNDESQHGLLMQLLKLSYNCLNYDFIGTS… |
| A0A2G8KWL3 | 144-281 | VEHFIIGVQLMSQLVAEMNQPDNIRPLTRHRKIASSFRDTVLFDIFTMACNLLKQASEEGVDYNDEQKHSVMNQLLQLTRNCLTFDF… |
| A0A445IKQ2 | 5-113 | None |
| A0A482UDY3 | 14-145 | None |
| A0A401STV3 | 28-165 | None |
| A0A2Z6MP44 | 4-122 | None |
| A0A1D6LUD5 | 1-95 | None |
| A0A183KGF5 | 148-295 | None |
| A0A426XT44 | 1-103 | None |
| A0A7J5YJF8 | 452-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.