DPCstruct | MC2906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 211 ± 44 aa |
| Standard deviation of domain lengths | 44.00 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 68.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF10251- PF15306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7PXD6 | 25-171 | RKRKKRDFASSDVEQLDDNTKSRNSFVMKLFDRSVDLASFRPNAPLYPVCRAWMSNSPTAKMPRRDLSPSPEPLPDSDVSENGLIYR… |
| A0A224YF72 | 5-232 | KEKRVSELEQARSKLDGILQSLMEKTEESQSSSSQSEDESKALDSTTKDASPKKVQKTQRKRRRKDDSAVQNSNTYITKIYGCSVDL… |
| A0A5K3FZ17 | 7-163 | None |
| A0A7J7J9L7 | 4-199 | None |
| A0A674J5J2 | 82-298 | None |
| S9X161 | 93-344 | None |
| T1FIW7 | 10-246 | None |
| R7T8A7 | 16-144 | None |
| A0A6L5D7V5 | 55-356 | None |
| E0VUC6 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.