DPCstruct | MC29057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 247 ± 27 aa |
| Standard deviation of domain lengths | 27.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521UA46 | 51-333 | ASGHGRPYREQLPGRVTDATLAGYLTPLPADVRRTAVAAGVEPLIARLLEARARSHGTPSLDALALRQELAERVASLETQLLATEFE… |
| A0A136JRL4 | 2-217 | RSLAVRQELSDRLLLALFEANSIAAELECEKERAEDLASQLEEVRNDIQQGRTIMAILADSISGVFAGTFLLLGSEVLSGIIDLSGS… |
| F0NY17 | 2-237 | None |
| A0A0K1QEC7 | 51-286 | None |
| A0A533XQL8 | 19-272 | None |
| A0A836VC14 | 49-323 | None |
| A0A352FPF8 | 224-486 | None |
| A0A3S4NY25 | 2-190 | None |
| A0A1Q3Q147 | 65-324 | None |
| A0A3S0LBS3 | 455-714 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.