DPCstruct | MC29050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 506 ± 82 aa |
| Standard deviation of domain lengths | 81.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF13946- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A1P251 | 40-427 | KPHFLAASSALVHVPFLFWLVEAHAPTRVVQLGVDDGVAYQAVCQAIDKLGLDAVCTGISLPGKQEANPDAIANNDSLYGAFSILTT… |
| A0A5M6J2H6 | 30-610 | SYGQCAEDLIVCALLVALAAREGLDLGHERYLEIGANHPVSCSTTYLLHRRLNMCGVLVEANPRLLDELRRFRPQDLVLHLAITPQG… |
| A0A7W4JW17 | 315-853 | None |
| A0A2N1DBI6 | 17-581 | None |
| A0A2S7FM04 | 22-579 | None |
| A0A410NVU7 | 7-531 | None |
| A0A2E3IM75 | 25-657 | None |
| A0A0Q5PEL8 | 2-381 | None |
| A0A5S4ZXM1 | 91-466 | None |
| A0A1E2S2V2 | 721-1144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.