DPCstruct | MC2905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023G6X9 | 51-140 | LKGTFDRDNINQMMVAMPGMEVQTVEELIYSTANYSCGIFYVTSGMASTGWYELRFKDYMDTDEPDMACVKYFEALRIPGSVLYNKW… |
| A0A224YER9 | 33-119 | GTSCALRNEADMQQLCTEILRFLAGDLSCAVVKVKSITERGKSRYDLRVRNSSLVRAKPQAECTRHFRRAVKGGMAYHVYSSRCQRV |
| A0A131YFP3 | 3-81 | None |
| A0A131YD98 | 34-103 | None |
| A0A131YC22 | 1-89 | None |
| A0A6M2CID1 | 94-196 | None |
| B5M7B6 | 45-125 | None |
| A0A224YN42 | 27-102 | None |
| A0A224YMW3 | 44-132 | None |
| A0A224YM61 | 12-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.