DPCstruct | MC29049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1A9J6 | 1-98 | MEKYIFKSTGQYLGFVRNDYVFSRDNLYLGWVEGDIVWDIGGNFRGKLIQLADYWYILRNPFTINPIPKIPKPIPPSSPLPKPPVNI… |
| A0A5M6IVF1 | 18-116 | APRTSGLIWLWTAGGKSFGYRLGDELWSLSGRHCGRFVGNQVFSMTGAYRGEVIHGNRLVTNLAWRNLNQPGFLPALCWVGVPGRSD… |
| A0A233SL40 | 106-204 | None |
| A0A433IC50 | 13-108 | None |
| A0A0L6JMA7 | 18-115 | None |
| A0A136LLN0 | 7-123 | None |
| A0A1F8Q9K8 | 6-103 | None |
| A0A356ARR1 | 129-231 | None |
| A0A6J5CU03 | 2-96 | None |
| A0A2V8TQD6 | 21-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.