DPCstruct | MC29048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 163 ± 29 aa |
| Standard deviation of domain lengths | 29.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M6ITH1 | 5-177 | YSREQRLIHWTVAGLVVAQILIGISLAKLLQSSPENADELSRMLGLHGGTGTLLFVLMAWRLSLRRRLGVPPPPEGTPEDVSTLARL… |
| A0A4Q3GHN4 | 2-156 | APATYSKTQIALHWIVMLLVLFQIVAHDEIVRLWTGRMDGTLPNAATPNVHVAVGVLIFALVGWRLVLRLRRGVPALPANEHPLLKV… |
| A0A090MHE0 | 21-133 | None |
| A0A351T5H2 | 66-249 | None |
| A0A160UC25 | 7-182 | None |
| A0A7R9YF95 | 12-154 | None |
| A0A7R9UEY2 | 48-233 | None |
| W0BF60 | 8-178 | None |
| A0A5M8PAM7 | 25-220 | None |
| A0A515DFL4 | 102-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.