DPCstruct | MC29043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 143 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A137QXT5 | 313-466 | SICMTLLAEIYSSEFADMPGVNTSGTQHVKPCFRLEYGRSPIRDFGICKGKIRGNTNAVQVWTYKDEKTQTSTTLTDPDKYYWIYFT… |
| A0A0L6WCE5 | 1-140 | MSVCMGLLREMYISTPETDRRVRLRHGKSLISDFGIAKGRATVQNQDKLAYFYLTDDTFKRGQDPNEHQWLYFTILSSMKMIFDVGM… |
| A0A137QXJ6 | 1-164 | None |
| A0A409W4D2 | 14-162 | None |
| A0A0C3C9L3 | 158-289 | None |
| A0A0C9W3W3 | 297-429 | None |
| K5WPA2 | 9-164 | None |
| A0A137QQ70 | 235-371 | None |
| A0A409X8L9 | 75-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.