DPCstruct | MC29042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 134 ± 6 aa |
| Standard deviation of domain lengths | 6.48 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2D3P2 | 152-282 | EYLFSSLKCLGIVNTVSEAAVEDPTPRHCVRCHGTYHEKDNGLRMCKVGHDRGVLVNINERPGYVGHYFPCCGLVLETNERIEDAMG… |
| A0A0C3LKX7 | 106-248 | EQVASLSKLLEGLTPPPTLHCARCHQDYLEEENYDRICVIDHDDNSTEVRHHETFWGCCGASTEGQEPPAGWCFEGKHTDDRTKARY… |
| A0A0C3CIM3 | 45-175 | None |
| A0A369JSD2 | 1-139 | None |
| A0A067SVI6 | 128-262 | None |
| D8Q2M9 | 83-203 | None |
| A0A4Y7TGH4 | 82-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.