DPCstruct | MC2904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 155 ± 16 aa |
| Standard deviation of domain lengths | 15.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 27.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A131Z8D7 | 97-229 | KHCNHPYKGKGYAPNCQYPCPDDKRRTGSYPSGTPCIKVNSDGKREGAPGVCRNGDCITFELLDDQKELQKVFSQEYKNCTDKEHLT… |
| A0A131YEC4 | 8-164 | LCSSMLIVISISGGCCTAYNYGYGNNVCRGGRYPVRWNPCIYLCINNNVGRYRNYPDGTQCFFIVNRRTVSGRCFEGQCYRGATRPP… |
| A0A0K8RGL9 | 1-181 | None |
| A0A0K8R9H6 | 2-156 | None |
| V5IHN1 | 18-184 | None |
| A0A6G5A6F3 | 40-202 | None |
| A0A023G9U9 | 5-168 | None |
| A0A6P7UG85 | 19-179 | None |
| A0A224YC31 | 55-189 | None |
| V5IC80 | 47-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.