DPCstruct | MC29039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 137 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R8P618 | 157-296 | NVGDLKPMEFPTEFFLDYAWNPAAIPSDQLKNYTINWVQKQFGNGYKEEIADLVDTYLKYAGRVKPELLNANTYSLTNYNEWGRVIA… |
| A0A0L6W7S4 | 7-150 | PTRARLISFINFGWNATHWNVDNLESFVSSWAQRESAVSPVVAETIVDIVRNLTRYNSRRKPELIDTTTYSSNKYREADNVLADWAM… |
| E4ZZY4 | 203-309 | None |
| A0A0U5CMD9 | 44-185 | None |
| R5PCE3 | 2-120 | None |
| A0A175VX87 | 467-608 | None |
| A0A0J9WNU8 | 181-322 | None |
| W4QI95 | 115-239 | None |
| T2F5N3 | 251-382 | None |
| A0A6V8H7C7 | 279-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.