DPCstruct | MC29036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 16.66 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U6WY98 | 1-107 | MTPDREDDDDNDNDDQSEIKKGSPDPGGTTSPLLFDERLCLLDISQWTPVAIPNDLAVIAISHYLENDYATMPLFNADLFLQDLVGL… |
| A0A507B742 | 211-300 | SRGRPLPSADSLPQSTTGASKRYVDYRLEHLNVQPWTSVPVSDTLAARALSFYLSNEHPLLGVFDPDLVIRDLVRGSGRFCSPLLFS… |
| A0A0B4H1X3 | 86-211 | None |
| A0A1S8A790 | 80-180 | None |
| X0AKV9 | 328-470 | None |
| W9NGN8 | 5-136 | None |
| W9HVZ5 | 156-260 | None |
| A0A366SAN1 | 595-702 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.