DPCstruct | MC29034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 59.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A168BTK1 | 162-243 | LMSHLKDYVKATSDVMHFLTYADNYAIGYFKKQGFTKEITLDRSLWMGYIKDYEGGTIMQCSMLPKIRYLESGRMLLKQKET |
| A3C4R5 | 184-265 | LMNHLKQHARDADGLTHFLTYADNNAVGYFVKQGFTKEITLDKERWQGYIKDYDGGILMECRIDQKLPYVDLATMIRRQRQA |
| A0A397UU51 | 247-328 | None |
| A0A316UET2 | 465-553 | None |
| A0A0E9NBN6 | 270-357 | None |
| A0A4Y7L841 | 288-369 | None |
| A0A0K6GAA0 | 422-504 | None |
| A8N782 | 431-514 | None |
| A0A1D3D3B7 | 185-265 | None |
| A0A448YEC8 | 332-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.