DPCstruct | MC29030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 146 ± 24 aa |
| Standard deviation of domain lengths | 23.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540WW44 | 4-131 | RLLEQRPNLTLVGGDDITNVYSGDTTIDTLLPMLCLRQDGRPVPAGLVVDFYNGWAAGEVKLTAPLAGSVLGSRATADALCASQFGA… |
| L7F3D4 | 2-135 | LVDGAANGTVRVGADSATDPYYGDTPATATLPLLCLRVTGSGVPSGITPDFYAGWARGTVAATPPVQGKALTSLSVANSLCVQYYGT… |
| A0A1Q4ZAQ0 | 179-311 | None |
| A0A856MCZ0 | 3-143 | None |
| A0A7C1WDF5 | 21-178 | None |
| A0A7T9E885 | 58-236 | None |
| A0A818UYT7 | 146-269 | None |
| A0A1Q4Z7A5 | 16-150 | None |
| A0A3S1CJK3 | 339-495 | None |
| A0A2N2J9A1 | 107-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.