DPCstruct | MC2903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Standard deviation of domain lengths | 17.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517ZEM0 | 32-202 | NAEAAGGTANVATPGQPAYINPNWPEGTADLVNDPARTHGWNPWFSEWPNDVNHYGYAVESMEDVNRLVQKLAAIKTPLRRVLLAPT… |
| A0A5C6BKD9 | 2-148 | GGDYPEGPLAEQHTDWPAGLFELAKSEGRVSGHWVNSNDFFFYRGGAESLQKFLAVYGKVRDTPLKVVLHAGAVPLTGPLGKPKTIP… |
| A0A5C1ALR7 | 12-138 | None |
| A0A3D1TEZ7 | 55-227 | None |
| B9XAE2 | 3-154 | None |
| A0A518CI02 | 7-177 | None |
| A0A4Q5TPF8 | 19-156 | None |
| A0A5C6FAZ5 | 16-147 | None |
| A0A7V6YYT4 | 10-154 | None |
| A0A7X7YH77 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.