DPCstruct | MC29028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 206 ± 41 aa |
| Standard deviation of domain lengths | 40.77 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832AHY3 | 2-227 | TYALLQQSLDQTISRQQMEEASVAVPSVARADCAVLQRELFGIVVRGLERAEALAFQAALRMRGFPTDVVADDELPKLAEPVRGLAL… |
| A0A7V3KAY2 | 17-246 | TEEAHKFCIELNNLGIDAYLMKESGLKQVGQKQIALEAEIKDERIIFHLEDGGFRDLTYAEMFLIVRARVRMEGALAQKMGKATVPE… |
| A0A1H8CEQ9 | 164-323 | None |
| A0A660VEX4 | 94-292 | None |
| A0A521TKY4 | 21-210 | None |
| A0A2E7MFQ0 | 108-306 | None |
| A0A7X8XP27 | 43-187 | None |
| A0A1V5FNB9 | 193-468 | None |
| A0A3M1SZQ4 | 79-256 | None |
| A0A6N8G0Q0 | 3-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.