DPCstruct | MC29023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 111 ± 14 aa |
| Standard deviation of domain lengths | 13.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.50 |
| Pfam Score | 99.21 |
| Assigned Pfam label(s) | CL0031- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YG70 | 126-235 | KEVFPENGWNVYDPILEYRRQGIPNESWRMTSLNEQYELCDTYPALLVVPANIPDEELKKVAAFRSRGRIPVLSWIHPESQATITRC… |
| A0A183EHR0 | 20-124 | DGWNIFDTIREFNRMHVPNETWRITRINDRYDFADTYPAMLAVPATAIVEGEDFLQKVGEFRSKQRIPVLSWLHPITQASITRSSQP… |
| G4TAW5 | 357-459 | None |
| A0A1R0GL63 | 125-236 | None |
| A0A146KEF4 | 289-381 | None |
| A0A4T0I2U1 | 445-555 | None |
| A0A6J1WHH3 | 6-104 | None |
| A0A2C9KAK0 | 187-300 | None |
| A0A6I8PLV7 | 114-224 | None |
| A0A835JS02 | 222-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.