DPCstruct | MC29016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 211 ± 24 aa |
| Standard deviation of domain lengths | 23.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P9D306 | 88-296 | QLRKLVLEIIHRIPTNEHLRPHTKNILSVMFRFLETENEENVLICLRIIIELHKQFRPAITQEIHHFLDFVKQIYKELPKVVNRYFE… |
| A0A183EBD3 | 2-220 | SFQQLRKLVLELILRMSCNETMKQYGRILLSQLIKLIQVENEENALLAIKIIGEHQRAFKIPYSQEISAIINFFKTVYREMPQHITN… |
| A0A818A4I3 | 28-261 | None |
| A0A1S3INQ3 | 2-187 | None |
| A0A6A4K3A8 | 225-439 | None |
| A0A6P8H9X7 | 88-309 | None |
| A0A3Q0IPG8 | 2-215 | None |
| A0A6P4LBS7 | 3-174 | None |
| A0A3P6RTR3 | 2-242 | None |
| A0A0D8Y8B2 | 79-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.