DPCstruct | MC2901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 244 ± 36 aa |
| Standard deviation of domain lengths | 35.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.77 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0229- PF13919- PF06391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6NWV3 | 254-506 | VCCNCTAISDRSSGTGFYTAPCGHAYCESCLHRVFCLSSRITCRASVGGTGICGRLIERGQMKFSSSVDLVTERVTQTRRKVYEVMN… |
| F2U1C6 | 35-253 | ECPRCRTTRMRQPNLKLFVGTCGHSLCEVCLNQVFHNTPSYPCIVCRALRLRADYTPKLFEDGSVHRNVVIRKDKLKDLNLSLDDFQ… |
| A0A5D2K6J7 | 1-316 | None |
| A0A1I8FKZ0 | 3-170 | None |
| A0A498MKR8 | 36-269 | None |
| J4H3A2 | 1-265 | None |
| A0A0G2E6M1 | 12-250 | None |
| F4X185 | 141-417 | None |
| A0A4Y9YPU7 | 5-193 | None |
| A0A182Y0J0 | 13-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.