DPCstruct | MC29008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 123 ± 15 aa |
| Standard deviation of domain lengths | 15.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212C6F8 | 90-190 | MSTFIRRYSRYLNEKAFSYRQMAFDFARVKKGADGVMRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIK… |
| A0A183E7E2 | 3-136 | QHVRRYGKYISEKIYTYRLCAFDFCKVKRGREDGLLRTMNTDKVVAVYALENYIQNDGDLLLKTLPILQNQIDALLEFQVTSAELNN… |
| A0A1Y2BXT5 | 72-235 | None |
| A0A7J6ZB52 | 340-471 | None |
| A0A814Z396 | 109-224 | None |
| A0A1I8IDX4 | 76-189 | None |
| A0A1I8ILW7 | 104-220 | None |
| U4U6D0 | 17-138 | None |
| A0A6F9CA38 | 1-101 | None |
| A0A1I8GR57 | 124-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.