DPCstruct | MC29007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 3.45 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 60.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1WNK5 | 1-56 | AHRLWAHKSYKAKWPLRLILVAFNTLAFQDSAIDWSRDHRMHHKYSETDADPHNAT |
| A0A183E5X9 | 1-63 | MGITAGAHRLWSHRSYKARWPARVFLMLCNSMAFQNDVIEWSRDHRCHHKWTDTDADPHNTTR |
| A0A2W1BGE6 | 83-136 | None |
| V5IDH4 | 31-91 | None |
| A0A7R9Q720 | 17-77 | None |
| A0A4Y2IXV3 | 16-76 | None |
| A0A6P7FNF0 | 601-654 | None |
| A0A4C1V154 | 126-184 | None |
| A0A1A9WMI9 | 118-171 | None |
| A0A7R9DIH6 | 186-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.