DPCstruct | MC29006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 141 ± 16 aa |
| Standard deviation of domain lengths | 15.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5U2E9 | 128-266 | LGPSESGKFIVQHGNLVKINESGVTKVAEQILEAAKDGSIKEALFLSPELHPKSGDKEAVQWVFLVDTINFSFWPDEGAHYDVSWNG… |
| A0A183E4N8 | 7-138 | RLSPRESAKYVVTNSSGQIKLSEEGVQKAARLMLDAIRSGAYSEHSYSAIDVHPQNADRSAVDWIFLVDTINFSFWSEKSHFQVTFQ… |
| A0A6I9Q2K1 | 2-132 | None |
| A0A842Z9L0 | 21-137 | None |
| A0A556U267 | 9-161 | None |
| A0A101X542 | 1-147 | None |
| A0A2G9YXD1 | 1-123 | None |
| A0A654H9E8 | 10-161 | None |
| N1QE72 | 37-169 | None |
| A0A1U7LGH0 | 61-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.