DPCstruct | MC29005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 162 ± 15 aa |
| Standard deviation of domain lengths | 14.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8H9M9 | 67-229 | NHAIKAHCPIEMDDIPCLWSRCDGMKRKRFSLMTHIQDRHCHPQLMKLMAVRRVQLAQNGKSDVPLPPAPPPHPGYAPNAAYHAIKR… |
| A0A183E3P9 | 27-165 | RAKWSMVTHLQDHHCSEPALIAAAQKRREGQSLPLEPVNPERSREMVPHPGYSKNAAIEAIRRHAFNYLPRDITDDPEGPVTKSIRL… |
| A0A820XLI9 | 236-404 | None |
| A0A1I8HVM6 | 287-473 | None |
| A0A1I7YU06 | 864-1024 | None |
| A0A085MM26 | 1089-1256 | None |
| T1GBI2 | 1-161 | None |
| A0A6A4W8Y6 | 649-812 | None |
| S4P2H8 | 31-188 | None |
| F1KQY1 | 694-860 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.