DPCstruct | MC2900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 125 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L6GGJ6 | 109-231 | QDEQSFTSLDLFWITCLSFFSFIMFKYWAIPLWNLPEHRVIKAPMSLISFAEDHADLEMYRDKDRNQITRVTKFKGTCPICTSDVIL… |
| A0A3D3KG56 | 1-119 | MSGNPHNREWSDAYLLTHRIIKAPELFLNANIDNADIEMYKGKDGYKVARVTEFIATCPICSAPIELADGKPDQKAPLVGRCREAPH… |
| A0A8A8V8L6 | 74-197 | None |
| A0A2A2FNU8 | 1-127 | None |
| A0A432XDH1 | 194-313 | None |
| A0A7C6VM84 | 258-374 | None |
| A0A550EZT2 | 94-225 | None |
| A0A162U8L3 | 122-245 | None |
| A0A653HYW9 | 1-153 | None |
| L0E116 | 380-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.