DPCstruct | MC290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 8.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 65.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04923 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0APU3 | 4-110 | YANKKSVAESMLDIALLMANASQLKAVVEQGPGFAFFIPMVVLISISLALQISVGVLLIILVRYDLNNPAKHAKLDFLNNLATGLVF… |
| A0A6P4GPM1 | 11-120 | MDANRYATKKTIAQGMLDIALLTANASQLKYILQVGETHQFYKLMLILISLSIVLQLLVGILFVAIGSLNINRQQDQTAAVILNDVI… |
| A0A3Q2QL25 | 78-178 | None |
| M4ASV6 | 27-139 | None |
| D3PJK8 | 2-125 | None |
| A0A165A4U3 | 236-345 | None |
| A0A1W0XE65 | 82-200 | None |
| A0A3Q3F576 | 19-132 | None |
| A0A6J0WN17 | 47-177 | None |
| F5H3L1 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.